Lineage for d4c9lb_ (4c9l B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.0: automated matches [191509] (1 protein)
not a true familyProtein automated matches [190847] (99 species)
not a true protein
Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (11 PDB entries) 
Domain d4c9lb_: 4c9l B: [229383]
automated match to d3lxia_
complexed with cam, cyn, hem
Details for d4c9lb_
PDB Entry: 4c9l (more details), 1.8 Å
PDB Description: Structure of Cyanide and Camphor bound wild type CYP101D1
PDB Compounds: (B:) cytochrome p450SCOPe Domain Sequences for d4c9lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c9lb_ a.104.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg
tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle
dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps
gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv
sllllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv
sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl
arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
SCOPe Domain Coordinates for d4c9lb_:
Click to download the PDB-style file with coordinates for d4c9lb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4c9lb_:
- d4c9lb_ first appeared in SCOPe 2.03
- d4c9lb_ appears in SCOPe 2.07
View in 3D
