Lineage for d4c2ab_ (4c2a B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamiliesSuperfamily c.10.2: L domain-like [52058] (9 families) 
less regular structure consisting of variable repeats
Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
applies to all domains of a family if the common domain is composed of a different number of small repeating units
this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
Protein automated matches [235852] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [235853] (2 PDB entries) 
Domain d4c2ab_: 4c2a B: [235854]
Other proteins in same PDB: d4c2aa_
automated match to d1p8va_
complexed with act, ca, cac, peg; mutant
Details for d4c2ab_
PDB Entry: 4c2a (more details), 2.08 Å
PDB Description: crystal structure of high-affinity von willebrand factor a1 domain with r1306q and i1309v mutations in complex with high affinity gpib alpha
PDB Compounds: (B:) platelet glycoprotein ib alpha chainSCOPe Domain Sequences for d4c2ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2ab_ c.10.2.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt
snvasvqcdnsdkfpvykypgkgcpt
SCOPe Domain Coordinates for d4c2ab_:
Click to download the PDB-style file with coordinates for d4c2ab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4c2ab_:
- d4c2ab_ first appeared in SCOPe 2.03
- d4c2ab_ appears in SCOPe 2.07
View in 3D
