Lineage for d4c22a2 (4c22 A:354-588)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791674Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) (S)
  5. 1791693Family b.43.2.0: automated matches [227252] (1 protein)
    not a true family
  6. 1791694Protein automated matches [227032] (4 species)
    not a true protein
  7. 1791728Species Streptococcus pneumoniae [TaxId:170187] [229525] (3 PDB entries)
  8. 1791733Domain d4c22a2: 4c22 A:354-588 [229528]
    Other proteins in same PDB: d4c22a1, d4c22b1
    automated match to d1fuia1
    complexed with cvu, edo, fuc, mn

Details for d4c22a2

PDB Entry: 4c22 (more details), 2.7 Å

PDB Description: l-fucose isomerase in complex with fuculose
PDB Compounds: (A:) l-fucose isomerase

SCOPe Domain Sequences for d4c22a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c22a2 b.43.2.0 (A:354-588) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
pqifadvrtywspeavkrvtghtlegraaagflhlinsgsctldgtgqatrdgkpimkpf
weleesevqamlentdfppanreyfrgggfstrfltkgdmpvtmvrlnllkgvgpvlqia
egytlelpedvhhtldnrtdpgwpttwfaprltgkgafksvydvmnnwganhgaityghi
gadlitlasmlripvnmhnvpeedifrpknwslfgtedlesadyracqllgplhk

SCOPe Domain Coordinates for d4c22a2:

Click to download the PDB-style file with coordinates for d4c22a2.
(The format of our PDB-style files is described here.)

Timeline for d4c22a2:

1791733
d4c22a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4c22a1