Lineage for d4bx3b_ (4bx3 B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.0: automated matches [191369] (1 protein)
not a true familyProtein automated matches [190447] (45 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [193863] (6 PDB entries) 
Domain d4bx3b_: 4bx3 B: [229997]
automated match to d2hx1a_
complexed with gol, mg
Details for d4bx3b_
PDB Entry: 4bx3 (more details), 2.19 Å
PDB Description: Crystal Structure of murine Chronophin (Pyridoxal Phosphate Phosphatase)
PDB Compounds: (B:) pyridoxal phosphate phosphataseSCOPe Domain Sequences for d4bx3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bx3b_ c.108.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn
srrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglra
elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl
sdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi
lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegle
SCOPe Domain Coordinates for d4bx3b_:
Click to download the PDB-style file with coordinates for d4bx3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bx3b_:
- d4bx3b_ first appeared in SCOPe 2.03
- d4bx3b_ appears in SCOPe 2.05
- d4bx3b_ appears in the current release, SCOPe 2.08
View in 3D
