Lineage for d4bsha_ (4bsh A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimers
Family b.19.1.0: automated matches [227246] (1 protein)
not a true familyProtein automated matches [227017] (14 species)
not a true protein
Species Influenza virus (a/turkey/italy/214845/2002(h7n3)) [TaxId:265120] [226709] (1 PDB entry) 
Domain d4bsha_: 4bsh A: [219546]
Other proteins in same PDB: d4bshb_
automated match to d1rd8a_
complexed with nag, so4
Details for d4bsha_
PDB Entry: 4bsh (more details), 2.25 Å
PDB Description: h7n3 avian influenza virus haemagglutinin in complex with human receptor analogue 6'-sln
PDB Compounds: (A:) HemagglutininSCOPe Domain Sequences for d4bsha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bsha_ b.19.1.0 (A:) automated matches {Influenza virus (a/turkey/italy/214845/2002(h7n3)) [TaxId: 265120]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslmlatgmknvpe
SCOPe Domain Coordinates for d4bsha_:
Click to download the PDB-style file with coordinates for d4bsha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bsha_:
- d4bsha_ first appeared in SCOPe 2.03
- d4bsha_ appears in SCOPe 2.05
- d4bsha_ appears in the current release, SCOPe 2.08
View in 3D
