Lineage for d4bsea_ (4bse A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimers
Family b.19.1.0: automated matches [227246] (1 protein)
not a true familyProtein automated matches [227017] (34 species)
not a true protein
Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries) 
Domain d4bsea_: 4bse A: [219543]
Other proteins in same PDB: d4bseb_
automated match to d1rd8a_
complexed with nag, so4
Details for d4bsea_
PDB Entry: 4bse (more details), 2.55 Å
PDB Description: human h7n9 influenza virus haemagglutinin in complex with human receptor analogue lstc
PDB Compounds: (A:) haemagglutinin ha1SCOPe Domain Sequences for d4bsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bsea_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpei
SCOPe Domain Coordinates for d4bsea_:
Click to download the PDB-style file with coordinates for d4bsea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bsea_:
- d4bsea_ first appeared in SCOPe 2.03
- d4bsea_ appears in SCOPe 2.05
- d4bsea_ appears in SCOPe 2.07
- d4bsea_ appears in the current release, SCOPe 2.08
View in 3D
