Lineage for d4bs0a_ (4bs0 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (26 species)
not a true protein
Species Thermoascus aurantiacus [TaxId:5087] [190006] (5 PDB entries) 
Domain d4bs0a_: 4bs0 A: [228291]
automated match to d1goka_
complexed with 6nt, so4
Details for d4bs0a_
PDB Entry: 4bs0 (more details), 1.09 Å
PDB Description: Crystal Structure of Kemp Eliminase HG3.17 E47N,N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
PDB Compounds: (A:) kemp eliminase hg3.17SCOPe Domain Sequences for d4bs0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bs0a_ c.1.8.3 (A:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
qsidqlikargkvyfgvatdqnrlttgknaaiikadfgmvwpensmqwdatepsqgnfnf
agadylvnwaqqngkligagclvwhnflpswvssitdkntlinvmknhittlmtrykgki
rtwdvvgeafnedgslrqnvflnvigedyipiafqtaraadpnaklyimdynldsasypk
tqaivnrvkqwraagvpidgigsqmhlsagqgagvlqalpllasagtpevsilmldvaga
sptdyvnvvnaclnvqscvgitvmgvadpdsafasstpllfdgnfnpkpaynaivqdlqq
SCOPe Domain Coordinates for d4bs0a_:
Click to download the PDB-style file with coordinates for d4bs0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bs0a_:
- d4bs0a_ first appeared in SCOPe 2.03
- d4bs0a_ appears in SCOPe 2.05
- d4bs0a_ appears in SCOPe 2.07
- d4bs0a_ appears in the current release, SCOPe 2.08
View in 3D
