Lineage for d4brwa2 (4brw A:251-421)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479742Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226311] (6 PDB entries)
  8. 2479747Domain d4brwa2: 4brw A:251-421 [234277]
    automated match to d2j0sa2
    complexed with 1pe, mpd

Details for d4brwa2

PDB Entry: 4brw (more details), 2.8 Å

PDB Description: Crystal structure of the yeast Dhh1-Pat1 complex
PDB Compounds: (A:) ATP-dependent RNA helicase dhh1

SCOPe Domain Sequences for d4brwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4brwa2 c.37.1.0 (A:251-421) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eeltlkgitqyyafveerqklhclntlfsklqinqaiifcnstnrvellakkitdlgysc
yysharmkqqernkvfhefrqgkvrtlvcsdlltrgidiqavnvvinfdfpktaetylhr
igrsgrfghlglainlinwndrfnlykieqelgteiaaipatidkslyvae

SCOPe Domain Coordinates for d4brwa2:

Click to download the PDB-style file with coordinates for d4brwa2.
(The format of our PDB-style files is described here.)

Timeline for d4brwa2:

2479747
d4brwa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4brwa1