Class a: All alpha proteins [46456] (286 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (17 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries) |
Domain d4bpfa_: 4bpf A: [256570] automated match to d1hqba_ |
PDB Entry: 4bpf (more details), 1.01 Å
SCOPe Domain Sequences for d4bpfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bpfa_ a.28.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mdfkqevldvlaevcqddivkenpdieifeeglldafgtvelllaienrfdilvpitefd rdvwntpnnivnqlselkrshhhhhh
Timeline for d4bpfa_: