Lineage for d4bpfa_ (4bpf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731062Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1731176Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 1731177Protein automated matches [191038] (17 species)
    not a true protein
  7. 1731183Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries)
  8. 1731184Domain d4bpfa_: 4bpf A: [256570]
    automated match to d1hqba_

Details for d4bpfa_

PDB Entry: 4bpf (more details), 1.01 Å

PDB Description: high resolution crystal structure of bacillus subtilis dltc s36a
PDB Compounds: (A:) d-alanine--poly(phosphoribitol) ligase subunit 2

SCOPe Domain Sequences for d4bpfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bpfa_ a.28.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mdfkqevldvlaevcqddivkenpdieifeeglldafgtvelllaienrfdilvpitefd
rdvwntpnnivnqlselkrshhhhhh

SCOPe Domain Coordinates for d4bpfa_:

Click to download the PDB-style file with coordinates for d4bpfa_.
(The format of our PDB-style files is described here.)

Timeline for d4bpfa_: