Lineage for d4bnri_ (4bnr I:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962693Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 1962694Protein automated matches [190829] (11 species)
    not a true protein
  7. 1962699Species Cow (Bos taurus) [TaxId:9913] [255754] (6 PDB entries)
  8. 1962707Domain d4bnri_: 4bnr I: [240032]
    Other proteins in same PDB: d4bnra_, d4bnrb_
    automated match to d4isnb_
    complexed with ca, so4

Details for d4bnri_

PDB Entry: 4bnr (more details), 2 Å

PDB Description: extremely stable complex of crayfish trypsin with bovine trypsin inhibitor
PDB Compounds: (I:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d4bnri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bnri_ g.8.1.0 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggai

SCOPe Domain Coordinates for d4bnri_:

Click to download the PDB-style file with coordinates for d4bnri_.
(The format of our PDB-style files is described here.)

Timeline for d4bnri_: