Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
Protein automated matches [191104] (14 species) not a true protein |
Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries) |
Domain d4blka_: 4blk A: [235972] automated match to d2vkaa_ complexed with ca, hem |
PDB Entry: 4blk (more details), 1.05 Å
SCOPe Domain Sequences for d4blka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4blka_ a.93.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]} atcadgrttanaaccvlfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg adgsiitfdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri pfflgrpdavaaspdhlvpepfdsvdtilarmgdagfsavevvwllashsiaaadkvdps ipgtpfdstpgvfdsqffietqlkgrlfpgtpdnkgevqsplqgeirlqsdhllardpqt acewqsmvnnqpkiqnrfagtmskmallgqdksklidcsdiiptppalvgaahlpagfsl sdveqacaetpfpaltadpgpvtsvppvpg
Timeline for d4blka_: