Lineage for d4bkpc_ (4bkp C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831330Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries)
  8. 1831406Domain d4bkpc_: 4bkp C: [219503]
    automated match to d4b8wa_
    complexed with edo, flc, nap

Details for d4bkpc_

PDB Entry: 4bkp (more details), 2.7 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp
PDB Compounds: (C:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4bkpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bkpc_ c.2.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdlgtenlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtr
alfekvqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclst
cifpdkttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfg
phdnfniedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreyn
evepiilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpd
frftpfkqavketcawftdnyeqark

SCOPe Domain Coordinates for d4bkpc_:

Click to download the PDB-style file with coordinates for d4bkpc_.
(The format of our PDB-style files is described here.)

Timeline for d4bkpc_: