Lineage for d4bk6a_ (4bk6 A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helixFamily d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) 
Protein Major tree pollen allergen [55963] (4 species) Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (18 PDB entries) 
Domain d4bk6a_: 4bk6 A: [229183]
automated match to d4a85a_
Details for d4bk6a_
PDB Entry: 4bk6 (more details), 1.63 Å
PDB Description: Crystal Structure of a dimeric variant of Bet v 1
PDB Compounds: (A:) major pollen allergen bet v 1-aSCOPe Domain Sequences for d4bk6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bk6a_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfncetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn
SCOPe Domain Coordinates for d4bk6a_:
Click to download the PDB-style file with coordinates for d4bk6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bk6a_:
- d4bk6a_ is new in SCOPe 2.03-stable
- d4bk6a_ appears in SCOPe 2.04
- d4bk6a_ appears in the current release, SCOPe 2.08
View in 3D
