Lineage for d4bj8e_ (4bj8 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073773Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2073774Protein automated matches [190537] (8 species)
    not a true protein
  7. 2073842Species Zebrafish (Danio rerio) [TaxId:7955] [229041] (1 PDB entry)
  8. 2073847Domain d4bj8e_: 4bj8 E: [229042]
    Other proteins in same PDB: d4bj8o2
    automated match to d4i60a_
    complexed with btn, gol

Details for d4bj8e_

PDB Entry: 4bj8 (more details), 2.4 Å

PDB Description: zebavidin
PDB Compounds: (E:) zebavidin

SCOPe Domain Sequences for d4bj8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bj8e_ b.61.1.0 (E:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt

SCOPe Domain Coordinates for d4bj8e_:

Click to download the PDB-style file with coordinates for d4bj8e_.
(The format of our PDB-style files is described here.)

Timeline for d4bj8e_: