Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (30 species) not a true protein |
Species Granulicella tundricola [TaxId:1198114] [256205] (1 PDB entry) |
Domain d4bifa_: 4bif A: [251255] automated match to d2f4pb_ complexed with mn |
PDB Entry: 4bif (more details), 2.46 Å
SCOPe Domain Sequences for d4bifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bifa_ b.82.1.0 (A:) automated matches {Granulicella tundricola [TaxId: 1198114]} meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw mehvtdeqyrr
Timeline for d4bifa_: