SCOPe 2.08: Domain d4bhta1: 4bht A:6-196

Lineage for d4bhta1 (4bht A:6-196)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)
Family c.58.1.0: automated matches [227157] (1 protein)
not a true family
Protein automated matches [226864] (40 species)
not a true protein
Species Escherichia coli [TaxId:562] [234160] (3 PDB entries)
Domain d4bhta1: 4bht A:6-196 [234161]
Other proteins in same PDB: d4bhta2, d4bhtb2, d4bhtc2, d4bhtd2, d4bhte2, d4bhtf2
automated match to d4fcca1
complexed with epe, gol, pg4

Details for d4bhta1

PDB Entry: 4bht (more details), 2.5 Å

PDB Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases

PDB Compounds: (A:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d4bhta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bhta1 c.58.1.0 (A:6-196) automated matches {Escherichia coli [TaxId: 562]}
slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
lsnntacvftg

SCOPe Domain Coordinates for d4bhta1:

Click to download the PDB-style file with coordinates for d4bhta1.
(The format of our PDB-style files is described here.)

Timeline for d4bhta1: