Lineage for d4bgva2 (4bgv A:151-324)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999725Species Picrophilus torridus [TaxId:82076] [256542] (1 PDB entry)
  8. 2999726Domain d4bgva2: 4bgv A:151-324 [256543]
    Other proteins in same PDB: d4bgva1, d4bgvb1, d4bgvc1, d4bgvd1
    automated match to d3p7ma2
    complexed with cit, peg, pg6

Details for d4bgva2

PDB Entry: 4bgv (more details), 1.81 Å

PDB Description: 1.8 a resolution structure of the malate dehydrogenase from picrophilus torridus in its apo form
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4bgva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgva2 d.162.1.0 (A:151-324) automated matches {Picrophilus torridus [TaxId: 82076]}
gsldstrfrtflaqelnvsfedvnafvigghgddmvpfirysnvsgipiedllprekide
ivkrtrfgggeivnlyktgsafyapgisiavmvesivndrkrvipcaayitgehsktylv
nnlfigvpikigkngvekiydlkfnedeleawkksvesvkknsaiaddyfaknq

SCOPe Domain Coordinates for d4bgva2:

Click to download the PDB-style file with coordinates for d4bgva2.
(The format of our PDB-style files is described here.)

Timeline for d4bgva2: