Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.0: automated matches [195065] (1 protein) not a true family |
Protein automated matches [195066] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries) |
Domain d4bdud2: 4bdu D:1054-1122 [265928] Other proteins in same PDB: d4bdua1, d4bdub1, d4bduc1, d4bdud1 automated match to d4bd7a_ |
PDB Entry: 4bdu (more details), 3 Å
SCOPe Domain Sequences for d4bdud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bdud2 f.1.4.0 (D:1054-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]} astkklseslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvval fyfasklvl
Timeline for d4bdud2: