Lineage for d4bdud2 (4bdu D:1054-1122)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2627094Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 2627095Protein automated matches [195066] (5 species)
    not a true protein
  7. 2627101Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 2627125Domain d4bdud2: 4bdu D:1054-1122 [265928]
    Other proteins in same PDB: d4bdua1, d4bdub1, d4bduc1, d4bdud1
    automated match to d4bd7a_

Details for d4bdud2

PDB Entry: 4bdu (more details), 3 Å

PDB Description: bax bh3-in-groove dimer (gfp)
PDB Compounds: (D:) green fluorescent protein, apoptosis regulator bax

SCOPe Domain Sequences for d4bdud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bdud2 f.1.4.0 (D:1054-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
astkklseslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvval
fyfasklvl

SCOPe Domain Coordinates for d4bdud2:

Click to download the PDB-style file with coordinates for d4bdud2.
(The format of our PDB-style files is described here.)

Timeline for d4bdud2: