Lineage for d4bdud1 (4bdu D:2-230)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547462Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (63 PDB entries)
  8. 2547559Domain d4bdud1: 4bdu D:2-230 [265927]
    Other proteins in same PDB: d4bdua2, d4bdub2, d4bduc2, d4bdud2
    automated match to d3vhta_

Details for d4bdud1

PDB Entry: 4bdu (more details), 3 Å

PDB Description: bax bh3-in-groove dimer (gfp)
PDB Compounds: (D:) green fluorescent protein, apoptosis regulator bax

SCOPe Domain Sequences for d4bdud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bdud1 d.22.1.1 (D:2-230) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsnlskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d4bdud1:

Click to download the PDB-style file with coordinates for d4bdud1.
(The format of our PDB-style files is described here.)

Timeline for d4bdud1: