Lineage for d4bcsa_ (4bcs A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (2 families) 
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) 
Protein automated matches [190191] (2 species)
not a true protein
Species Chicken (Gallus gallus) [TaxId:9031] [186931] (22 PDB entries) 
Domain d4bcsa_: 4bcs A: [228290]
automated match to d4i60a_
complexed with act, btn, peg, po4; mutant
Details for d4bcsa_
PDB Entry: 4bcs (more details), 1.8 Å
PDB Description: crystal structure of an avidin mutant
PDB Compounds: (A:) chimeric avidinSCOPe Domain Sequences for d4bcsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcsa_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtddlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndisddwiatrvginiftrqr
tqk
SCOPe Domain Coordinates for d4bcsa_:
Click to download the PDB-style file with coordinates for d4bcsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bcsa_:
- d4bcsa_ is new in SCOPe 2.03-stable
- d4bcsa_ appears in SCOPe 2.04
- d4bcsa_ appears in the current release, SCOPe 2.08
View in 3D
