Lineage for d4bbna_ (4bbn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676023Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 1676024Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 1676040Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 1676041Protein automated matches [226939] (1 species)
    not a true protein
  7. 1676042Species Human (Homo sapiens) [TaxId:9606] [225255] (8 PDB entries)
  8. 1676046Domain d4bbna_: 4bbn A: [234144]
    Other proteins in same PDB: d4bbnc_, d4bbnf_
    automated match to d2onia_

Details for d4bbna_

PDB Entry: 4bbn (more details), 2.51 Å

PDB Description: nedd4 hect-ub:ub complex
PDB Compounds: (A:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d4bbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bbna_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsrdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwief
dgekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsginpdhlsyfkfi
grvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldl
rfiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffe
lipqdlikifdenelellmsglgdvdvndwrehtkykngysanhqviqwfwkavlmmdse
krirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyes
feelwdklqmaientqgf

SCOPe Domain Coordinates for d4bbna_:

Click to download the PDB-style file with coordinates for d4bbna_.
(The format of our PDB-style files is described here.)

Timeline for d4bbna_: