Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein automated matches [193392] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
Domain d4b9ki_: 4b9k I: [194465] Other proteins in same PDB: d4b9ka_, d4b9kb1, d4b9kb2, d4b9kd_, d4b9ke_, d4b9kg_, d4b9kh_, d4b9kj_, d4b9kk1, d4b9kk2 automated match to d1lm8v_ complexed with act, tg0 |
PDB Entry: 4b9k (more details), 2 Å
SCOPe Domain Sequences for d4b9ki_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b9ki_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqeriah
Timeline for d4b9ki_: