Lineage for d4b9fb_ (4b9f B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) 
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
Pfam PF00963
Protein Cellusomal scaffolding protein A, scaffoldin [49391] (3 species) Species Clostridium thermocellum [TaxId:203119] [194716] (1 PDB entry) 
Domain d4b9fb_: 4b9f B: [194717]
automated match to d1nbca_
complexed with ca, so4
Details for d4b9fb_
PDB Entry: 4b9f (more details), 1.19 Å
PDB Description: High resolution structure for family 3a carbohydrate binding module from the cipA scaffolding of clostridium thermocellum
PDB Compounds: (B:) Cellulosomal-scaffolding protein ASCOPe Domain Sequences for d4b9fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b9fb_ b.2.2.2 (B:) Cellusomal scaffolding protein A, scaffoldin {Clostridium thermocellum [TaxId: 203119]}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwg
SCOPe Domain Coordinates for d4b9fb_:
Click to download the PDB-style file with coordinates for d4b9fb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4b9fb_:
- d4b9fb_ first appeared in SCOPe 2.02
- d4b9fb_ appears in SCOPe 2.06
- d4b9fb_ appears in the current release, SCOPe 2.08
View in 3D
