Lineage for d4b8wa_ (4b8w A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (181 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries) 
Domain d4b8wa_: 4b8w A: [193375]
automated match to d1bsva_
complexed with gdp, nap
Details for d4b8wa_
PDB Entry: 4b8w (more details), 2.75 Å
PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, tetragonal crystal form
PDB Compounds: (A:) GDP-l-fucose synthaseSCOPe Domain Sequences for d4b8wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b8wa_ c.2.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekv
qpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdk
ttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfn
iedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepii
lsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpf
kqavketcawftdnyeqar
SCOPe Domain Coordinates for d4b8wa_:
Click to download the PDB-style file with coordinates for d4b8wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4b8wa_:
- d4b8wa_ first appeared in SCOPe 2.02
- d4b8wa_ appears in SCOPe 2.03
- d4b8wa_ appears in SCOPe 2.05
- d4b8wa_ appears in the current release, SCOPe 2.08, called d4b8wa1
View in 3D
