Lineage for d4b6ra_ (4b6r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857823Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2857864Species Helicobacter pylori [TaxId:85962] [224882] (2 PDB entries)
  8. 2857867Domain d4b6ra_: 4b6r A: [219343]
    automated match to d1j2ya_
    complexed with 3dq, so4

Details for d4b6ra_

PDB Entry: 4b6r (more details), 2 Å

PDB Description: structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4b6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6ra_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 85962]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqkn

SCOPe Domain Coordinates for d4b6ra_:

Click to download the PDB-style file with coordinates for d4b6ra_.
(The format of our PDB-style files is described here.)

Timeline for d4b6ra_: