Lineage for d4b52b_ (4b52 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
includes alpha-helical C-terminal domain characteristic for the family
Protein automated matches [191194] (2 species)
not a true proteinSpecies Paenibacillus polymyxa [TaxId:1406] [193740] (2 PDB entries) 
Domain d4b52b_: 4b52 B: [193741]
automated match to d1npca_
complexed with ca, na, rdf, zn
Details for d4b52b_
PDB Entry: 4b52 (more details), 1.76 Å
PDB Description: Crystal structure of Gentlyase, the neutral metalloprotease of Paenibacillus polymyxa
PDB Compounds: (B:) BacillolysinSCOPe Domain Sequences for d4b52b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b52b_ d.92.1.2 (B:) automated matches {Paenibacillus polymyxa [TaxId: 1406]}
atgtgkgvlgdtksftttasgssyqlkdttrgngvvtytasnrqsipgtiltdadnvwnd
pagvdahtyaaktydyykakfgrnsidgrglqlrstvhygsrynnafwngsqmtygdgdg
stfiafsgdpdvvghelthgvteytsnleyygesgalneafsdvigndiqrknwlvgddi
ytpniagdalrsmsnptlydqpdhysnlytgssdnggvhtnsgiinkayyllaqggtfhg
vtvngigrdaavqiyysaftnyltsssdfsnaraaviqaakdqygansaeataaaksfda
vgvn
SCOPe Domain Coordinates for d4b52b_:
Click to download the PDB-style file with coordinates for d4b52b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4b52b_:
- d4b52b_ first appeared in SCOPe 2.02
- d4b52b_ appears in SCOPe 2.04
- d4b52b_ appears in SCOPe 2.06
- d4b52b_ appears in the current release, SCOPe 2.08
View in 3D
