Lineage for d4b52b_ (4b52 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963820Protein automated matches [191194] (3 species)
    not a true protein
  7. 2963821Species Paenibacillus polymyxa [TaxId:1406] [193740] (2 PDB entries)
  8. 2963825Domain d4b52b_: 4b52 B: [193741]
    automated match to d1npca_
    complexed with ca, na, rdf, zn

Details for d4b52b_

PDB Entry: 4b52 (more details), 1.76 Å

PDB Description: Crystal structure of Gentlyase, the neutral metalloprotease of Paenibacillus polymyxa
PDB Compounds: (B:) Bacillolysin

SCOPe Domain Sequences for d4b52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b52b_ d.92.1.2 (B:) automated matches {Paenibacillus polymyxa [TaxId: 1406]}
atgtgkgvlgdtksftttasgssyqlkdttrgngvvtytasnrqsipgtiltdadnvwnd
pagvdahtyaaktydyykakfgrnsidgrglqlrstvhygsrynnafwngsqmtygdgdg
stfiafsgdpdvvghelthgvteytsnleyygesgalneafsdvigndiqrknwlvgddi
ytpniagdalrsmsnptlydqpdhysnlytgssdnggvhtnsgiinkayyllaqggtfhg
vtvngigrdaavqiyysaftnyltsssdfsnaraaviqaakdqygansaeataaaksfda
vgvn

SCOPe Domain Coordinates for d4b52b_:

Click to download the PDB-style file with coordinates for d4b52b_.
(The format of our PDB-style files is described here.)

Timeline for d4b52b_: