Lineage for d4b36b_ (4b36 B:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (2 families) 
can be classified as disulfide-richFamily d.5.1.1: Ribonuclease A-like [54077] (9 proteins) 
Protein automated matches [190061] (7 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries) 
Domain d4b36b_: 4b36 B: [194194]
automated match to d1a4yb_
complexed with cl
Details for d4b36b_
PDB Entry: 4b36 (more details), 1.76 Å
PDB Description: Crystal Structure of Human Angiogenin with an Engineered Loop Exhibits Conformational Flexibility at the Functional Regions of the Molecule
PDB Compounds: (B:) angiogenin, eosinophil cationic-related proteinSCOPe Domain Sequences for d4b36b_:
Sequence, based on SEQRES records: (download)
>d4b36b_ d.5.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkngn
phrenlriskssfqvttcklttpspqnisncqyratagfrnvvvacenglpvhldqsifr
rp
Sequence, based on observed residues (ATOM records): (download)
>d4b36b_ d.5.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenphre
nlriskssfqvttcklttpsncqyratagfrnvvvacenglpvhldqsifrrp
SCOPe Domain Coordinates for d4b36b_:
Click to download the PDB-style file with coordinates for d4b36b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4b36b_:
- d4b36b_ first appeared in SCOPe 2.02
- d4b36b_ appears in SCOPe 2.06
- d4b36b_ appears in the current release, SCOPe 2.08
View in 3D
