Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.0: automated matches [191347] (1 protein) not a true family |
Protein automated matches [190255] (6 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [256196] (1 PDB entry) |
Domain d4b2oc_: 4b2o C: [251172] automated match to d1t70a_ complexed with fe2, po4 |
PDB Entry: 4b2o (more details), 1.64 Å
SCOPe Domain Sequences for d4b2oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b2oc_ d.159.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 224308]} mrilfigdvvgspgrdmvkeyvpklktkykphftiingenaahgkgltekiyhsliqsga daitmgnhtwdkkeifdfiddvpnlvrpanfpegtpgkgityvkangkelavinlqgrtf lpplddpflkadeliaeaakrtpyifidfhaeatseklalgwytdgrasavvgththvqt adnrilpkgtayitdvgmtgpydgilgmdretiikrfktnlpvrftvaegkttlsgvvid iddqtkkavkierilinddhmffe
Timeline for d4b2oc_: