Lineage for d4b2oc_ (4b2o C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998458Family d.159.1.0: automated matches [191347] (1 protein)
    not a true family
  6. 2998459Protein automated matches [190255] (6 species)
    not a true protein
  7. 2998460Species Bacillus subtilis [TaxId:224308] [256196] (1 PDB entry)
  8. 2998463Domain d4b2oc_: 4b2o C: [251172]
    automated match to d1t70a_
    complexed with fe2, po4

Details for d4b2oc_

PDB Entry: 4b2o (more details), 1.64 Å

PDB Description: Crystal structure of Bacillus subtilis YmdB, a global regulator of late adaptive responses.
PDB Compounds: (C:) ymdb phosphodiesterase

SCOPe Domain Sequences for d4b2oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b2oc_ d.159.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
mrilfigdvvgspgrdmvkeyvpklktkykphftiingenaahgkgltekiyhsliqsga
daitmgnhtwdkkeifdfiddvpnlvrpanfpegtpgkgityvkangkelavinlqgrtf
lpplddpflkadeliaeaakrtpyifidfhaeatseklalgwytdgrasavvgththvqt
adnrilpkgtayitdvgmtgpydgilgmdretiikrfktnlpvrftvaegkttlsgvvid
iddqtkkavkierilinddhmffe

SCOPe Domain Coordinates for d4b2oc_:

Click to download the PDB-style file with coordinates for d4b2oc_.
(The format of our PDB-style files is described here.)

Timeline for d4b2oc_: