Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
Protein automated matches [190792] (2 species) not a true protein |
Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries) |
Domain d4b2ab_: 4b2a B: [194886] Other proteins in same PDB: d4b2aa_, d4b2ac_ automated match to d1egla_ complexed with ca, edo, gol |
PDB Entry: 4b2a (more details), 1.89 Å
SCOPe Domain Sequences for d4b2ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b2ab_ d.40.1.1 (B:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} selksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvvn hvphvg
Timeline for d4b2ab_: