![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
![]() | Protein automated matches [190200] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [194798] (3 PDB entries) |
![]() | Domain d4az4a_: 4az4 A: [194799] automated match to d1bs4a_ complexed with co, h2s |
PDB Entry: 4az4 (more details), 1.8 Å
SCOPe Domain Sequences for d4az4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4az4a_ d.167.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]} svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldr
Timeline for d4az4a_: