Lineage for d4awjg_ (4awj G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892571Protein Elongin B [54246] (2 species)
  7. 1892572Species Human (Homo sapiens) [TaxId:9606] [54247] (27 PDB entries)
  8. 1892611Domain d4awjg_: 4awj G: [193391]
    Other proteins in same PDB: d4awjb_, d4awjc_, d4awje_, d4awjf_, d4awjh_, d4awji_, d4awjk_, d4awjl_
    automated match to d1lqba_
    complexed with act, acy, gol, v6f

Details for d4awjg_

PDB Entry: 4awj (more details), 2.5 Å

PDB Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
PDB Compounds: (G:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4awjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4awjg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4awjg_:

Click to download the PDB-style file with coordinates for d4awjg_.
(The format of our PDB-style files is described here.)

Timeline for d4awjg_: