Lineage for d4avsa_ (4avs A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. Domain d4avsa_: 4avs A: [197362]
    automated match to d3kqra_
    complexed with ca, n7p, nag

Details for d4avsa_

PDB Entry: 4avs (more details), 1.4 Å

PDB Description: structure of n-acetyl-l-proline bound to serum amyloid p component
PDB Compounds: (A:) serum amyloid p-component

SCOPe Domain Sequences for d4avsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avsa_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d4avsa_ are not available.

Timeline for d4avsa_:

Domains from other chains:
(mouse over for more information)
d4avsb_, d4avsc_, d4avsd_, d4avse_