Lineage for d4atja_ (4atj A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) 
Family a.93.1.1: CCP-like [48114] (5 proteins) 
Protein Plant peroxidase [48125] (6 species) Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries) 
Domain d4atja_: 4atj A: [81266]
complexed with bho, ca, hem; mutant
Details for d4atja_
PDB Entry: 4atj (more details), 2.5 Å
PDB Description: distal heme pocket mutant (h42e) of recombinant horseradish peroxidase in complex with benzhydroxamic acid
PDB Compounds: (A:) protein (peroxidase c1a)SCOPe Domain Sequences for d4atja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4atja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfedcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsns
SCOPe Domain Coordinates for d4atja_:
Click to download the PDB-style file with coordinates for d4atja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4atja_:
- d4atja_ first appeared in SCOP 1.63
- d4atja_ appears in SCOPe 2.04
- d4atja_ is called d4atja1 in SCOPe 2.06
- d4atja_ appears in the current release, SCOPe 2.08, called d4atja1
View in 3D
