Lineage for d4ap4b_ (4ap4 B:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) 
Protein automated matches [190124] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries) 
Domain d4ap4b_: 4ap4 B: [194914]
Other proteins in same PDB: d4ap4c_, d4ap4f_
automated match to d2c4pb_
complexed with zn
Details for d4ap4b_
PDB Entry: 4ap4 (more details), 2.21 Å
PDB Description: rnf4 - ubch5a - ubiquitin heterotrimeric complex
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d1SCOPe Domain Sequences for d4ap4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ap4b_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgsmalkriqkelsdlqrdppahcragpvgddlfhwqatimgppdsayqggvffltvhf
ptdypfkppkiafttkiyhpninsngsikldilrsqwspaltvskvllsicsllcdpnpd
dplvpdiaqiyksdkekynrharewtqkyam
SCOPe Domain Coordinates for d4ap4b_:
Click to download the PDB-style file with coordinates for d4ap4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ap4b_:
- d4ap4b_ first appeared in SCOPe 2.02
- d4ap4b_ appears in SCOPe 2.03
- d4ap4b_ appears in SCOPe 2.05
- d4ap4b_ appears in the current release, SCOPe 2.08, called d4ap4b1
View in 3D
