Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Angiogenin [54094] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries) |
Domain d4aoha_: 4aoh A: [194572] automated match to d1a4yb_ complexed with tar, tla |
PDB Entry: 4aoh (more details), 1.04 Å
SCOPe Domain Sequences for d4aoha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aoha_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]} aqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen kngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsi frr
Timeline for d4aoha_: