Lineage for d4amva2 (4amv A:1-240)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594582Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 proteins)
    has slightly different topology than other families do
  6. 2594628Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 2594629Species Escherichia coli [TaxId:562] [56238] (7 PDB entries)
    Uniprot P17169 1-238
  8. 2594641Domain d4amva2: 4amv A:1-240 [219057]
    Other proteins in same PDB: d4amva1, d4amvb1, d4amvc1
    complexed with f6r

Details for d4amva2

PDB Entry: 4amv (more details), 2.05 Å

PDB Description: e.coli glucosamine-6p synthase in complex with fructose-6p
PDB Compounds: (A:) glucosamine--fructose-6-phosphate aminotransferase [isomer izing]

SCOPe Domain Sequences for d4amva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4amva2 d.153.1.1 (A:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOPe Domain Coordinates for d4amva2:

Click to download the PDB-style file with coordinates for d4amva2.
(The format of our PDB-style files is described here.)

Timeline for d4amva2:

2594641
d4amva2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4amva1