Lineage for d4ahob_ (4aho B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. Protein automated matches [190115] (94 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)
  8. Domain d4ahob_: 4aho B: [218871]
    automated match to d2ehhc_
    complexed with cl

Details for d4ahob_

PDB Entry: 4aho (more details), 2 Å

PDB Description: Crystal Structure of N-acetylneuraminic acid lyase from Staphylococcus aureus with the chemical modification thia-lysine at position 165
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4ahob_:

Sequence, based on SEQRES records: (download)

>d4ahob_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

Sequence, based on observed residues (ATOM records): (download)

>d4ahob_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
dyyfdiieatqnnmiiyisieqfselfnhekivgvkytapnffllerirkafpdklilsg
fdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsm
giyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d4ahob_ are not available.

Timeline for d4ahob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ahoa_, d4ahoc_, d4ahod_