Lineage for d4ah9a_ (4ah9 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (15 families) 
consists of one domain of this foldFamily c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) 
Protein automated matches [190209] (5 species)
not a true proteinSpecies Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries) 
Domain d4ah9a_: 4ah9 A: [218864]
automated match to d2itga_
complexed with 0mb, cl, edo, gol, so4, tam
Details for d4ah9a_
PDB Entry: 4ah9 (more details), 1.7 Å
PDB Description: Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
PDB Compounds: (A:) integraseSCOPe Domain Sequences for d4ah9a_:
Sequence, based on SEQRES records: (download)
>d4ah9a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdiqtk
Sequence, based on observed residues (ATOM records): (download)
>d4ah9a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkgggysagerivdiiatdiqtk
SCOPe Domain Coordinates for d4ah9a_:
Click to download the PDB-style file with coordinates for d4ah9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ah9a_:
- d4ah9a_ first appeared in SCOPe 2.03
- d4ah9a_ appears in SCOPe 2.05
- d4ah9a_ appears in SCOPe 2.07
- d4ah9a_ appears in the current release, SCOPe 2.08
View in 3D
