Lineage for d4ag7a_ (4ag7 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209905Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194915] (2 PDB entries)
  8. 2209906Domain d4ag7a_: 4ag7 A: [194919]
    automated match to d1i21a_
    complexed with coa

Details for d4ag7a_

PDB Entry: 4ag7 (more details), 1.55 Å

PDB Description: C. elegans glucosamine-6-phosphate N-acetyltransferase (GNA1): coenzyme A adduct
PDB Compounds: (A:) glucosamine-6-phosphate n-acetyltransferase

SCOPe Domain Sequences for d4ag7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ag7a_ d.108.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mshifdasvlaphipsnlpdnfkvrplakddfskgyvdllsqltsvgnldqeafekrfea
mrtsvpnyhivviedsnsqkvvasaslvvemkfihgagsrgrvedvvvdtemrrqklgav
llktlvslgkslgvykislecvpellpfysqfgfqddcnfmtqrf

SCOPe Domain Coordinates for d4ag7a_:

Click to download the PDB-style file with coordinates for d4ag7a_.
(The format of our PDB-style files is described here.)

Timeline for d4ag7a_: