Lineage for d4aeca_ (4aec A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. Protein automated matches [190215] (38 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256179] (1 PDB entry)
  8. Domain d4aeca_: 4aec A: [251017]
    automated match to d3vbec_
    complexed with act, gol, plp

Details for d4aeca_

PDB Entry: 4aec (more details), 2.4 Å

PDB Description: crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyase c
PDB Compounds: (A:) cysteine synthase, mitochondrial

SCOPe Domain Sequences for d4aeca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aeca_ c.79.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
avkretgpdglniadnvsqligktpmvylnsiakgcvaniaakleimepccsvkdrigys
mvtdaeqkgfispgksvlveptsgntgiglafiaasrgyrliltmpasmsmerrvllkaf
gaelvltdpakgmtgavqkaeeilkntpdaymlqqfdnpanpkihyettgpeiwddtkgk
vdifvagigtggtitgvgrfikeknpktqvigveptesdilsggkpgphkiqgigagfip
knldqkimdeviaisseeaietakqlalkeglmvgissgaaaaaaikvakrpenagklia
vvfpsfgerylstplfqsireev

SCOPe Domain Coordinates for d4aeca_ are not available.

Timeline for d4aeca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4aecb_