Lineage for d4ac7a_ (4ac7 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175263Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2175264Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2175265Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2175266Protein Urease, gamma-subunit [54113] (4 species)
  7. 2175267Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries)
  8. 2175269Domain d4ac7a_: 4ac7 A: [192590]
    Other proteins in same PDB: d4ac7b_, d4ac7c1, d4ac7c2
    automated match to d4ubpa_
    complexed with edo, flc, ni, oh, so4

Details for d4ac7a_

PDB Entry: 4ac7 (more details), 1.5 Å

PDB Description: the crystal structure of sporosarcina pasteurii urease in complex with citrate
PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d4ac7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac7a_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d4ac7a_:

Click to download the PDB-style file with coordinates for d4ac7a_.
(The format of our PDB-style files is described here.)

Timeline for d4ac7a_: