Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Arsenite-oxidising bacterium [TaxId:97708] [256174] (1 PDB entry) |
Domain d4aayb_: 4aay B: [250978] automated match to d1g8kb_ complexed with 4mo, f3s, fes, mgd, o |
PDB Entry: 4aay (more details), 2.7 Å
SCOPe Domain Sequences for d4aayb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aayb_ b.33.1.0 (B:) automated matches {Arsenite-oxidising bacterium [TaxId: 97708]} aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic phkgfplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv deliygrlsnvl
Timeline for d4aayb_: