| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
| Protein Major tree pollen allergen [55963] (4 species) |
| Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (22 PDB entries) |
| Domain d4a85a_: 4a85 A: [193788] automated match to d1b6fa_ complexed with h35, mpd, so4, trs |
PDB Entry: 4a85 (more details), 1.4 Å
SCOPe Domain Sequences for d4a85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a85a_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn
Timeline for d4a85a_: