Lineage for d4a82a2 (4a82 A:324-578)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870366Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species)
  7. 2870367Species Human (Homo sapiens) [TaxId:9606] [224888] (1 PDB entry)
  8. 2870368Domain d4a82a2: 4a82 A:324-578 [218703]
    Other proteins in same PDB: d4a82a1, d4a82b1, d4a82c1, d4a82d1
    automated match to d2hyda1

Details for d4a82a2

PDB Entry: 4a82 (more details), 2 Å

PDB Description: Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic fibrosis transmembrane conductance regulator volume map EMD-1966.
PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d4a82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a82a2 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Human (Homo sapiens) [TaxId: 9606]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

SCOPe Domain Coordinates for d4a82a2:

Click to download the PDB-style file with coordinates for d4a82a2.
(The format of our PDB-style files is described here.)

Timeline for d4a82a2: