SCOPe 2.08: Domain d4a82a2: 4a82 A:324-578

Lineage for d4a82a2 (4a82 A:324-578)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
division into families based on beta-sheet topologies

Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
there are two additional subdomains inserted into the central core that has a RecA-like topology
missing some secondary structures that made up less than one-third of the common domain

Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [224888] (1 PDB entry)
Domain d4a82a2: 4a82 A:324-578 [218703]
Other proteins in same PDB: d4a82a1, d4a82b1, d4a82c1, d4a82d1
automated match to d2hyda1

Details for d4a82a2

PDB Entry: 4a82 (more details), 2 Å

PDB Description: Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic fibrosis transmembrane conductance regulator volume map EMD-1966.

PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d4a82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a82a2 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Human (Homo sapiens) [TaxId: 9606]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

SCOPe Domain Coordinates for d4a82a2:

Click to download the PDB-style file with coordinates for d4a82a2.
(The format of our PDB-style files is described here.)

Timeline for d4a82a2: