Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Methionine aminopeptidase [55924] (6 species) |
Species Escherichia coli [TaxId:562] [55925] (31 PDB entries) Uniprot P07906 |
Domain d4a6va_: 4a6v A: [195199] automated match to d2ggca_ complexed with co3, iky, mn |
PDB Entry: 4a6v (more details), 1.46 Å
SCOPe Domain Sequences for d4a6va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a6va_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt dngceiltlrkddtipaiishdea
Timeline for d4a6va_: