Lineage for d4a6va_ (4a6v A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668263Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 1668264Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 1668265Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 1668313Protein Methionine aminopeptidase [55924] (6 species)
  7. 1668324Species Escherichia coli [TaxId:562] [55925] (31 PDB entries)
    Uniprot P07906
  8. 1668325Domain d4a6va_: 4a6v A: [195199]
    automated match to d2ggca_
    complexed with co3, iky, mn

Details for d4a6va_

PDB Entry: 4a6v (more details), 1.46 Å

PDB Description: x-ray structures of oxazole hydroxamate ecmetap-mn complexes
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d4a6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6va_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishdea

SCOPe Domain Coordinates for d4a6va_:

Click to download the PDB-style file with coordinates for d4a6va_.
(The format of our PDB-style files is described here.)

Timeline for d4a6va_: