Lineage for d4a4ia_ (4a4i A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.0: automated matches [191416] (1 protein)
not a true familyProtein automated matches [190576] (50 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) 
Domain d4a4ia_: 4a4i A: [234027]
automated match to d3i2za_
complexed with gol, so4
Details for d4a4ia_
PDB Entry: 4a4i (more details), 1.95 Å
PDB Description: Crystal structure of the human Lin28b cold shock domain
PDB Compounds: (A:) protein lin-28 homolog bSCOPe Domain Sequences for d4a4ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a4ia_ b.40.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrgtghckwfnvrmgfgfisminregspldipvdvfvhqsklfmegfrslkegepveft
fkksskglesirvtgpggspclgs
SCOPe Domain Coordinates for d4a4ia_:
Click to download the PDB-style file with coordinates for d4a4ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4a4ia_:
- d4a4ia_ first appeared in SCOPe 2.03
- d4a4ia_ appears in SCOPe 2.06
- d4a4ia_ appears in the current release, SCOPe 2.08
View in 3D
