Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186749] (8 PDB entries) |
Domain d3zxfb_: 3zxf B: [186653] automated match to d1bkza_ complexed with act |
PDB Entry: 3zxf (more details), 1.38 Å
SCOPe Domain Sequences for d3zxfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxfb_ b.29.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pamsnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldts evvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplar vrlvevggdvqldsvrif
Timeline for d3zxfb_: