Lineage for d3zxfb_ (3zxf B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) 
Protein automated matches [190029] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186749] (8 PDB entries) 
Domain d3zxfb_: 3zxf B: [186653]
automated match to d1bkza_
complexed with act
Details for d3zxfb_
PDB Entry: 3zxf (more details), 1.38 Å
PDB Description: High resolution structure of Human Galectin-7
PDB Compounds: (B:) galectin-7SCOPe Domain Sequences for d3zxfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxfb_ b.29.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pamsnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldts
evvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplar
vrlvevggdvqldsvrif
SCOPe Domain Coordinates for d3zxfb_:
Click to download the PDB-style file with coordinates for d3zxfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zxfb_:
- d3zxfb_ first appeared in SCOPe 2.01
- d3zxfb_ appears in SCOPe 2.04
- d3zxfb_ is called d3zxfb1 in SCOPe 2.06
- d3zxfb_ appears in the current release, SCOPe 2.08, called d3zxfb1
View in 3D
