Lineage for d3zska_ (3zsk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780718Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 1780837Protein Galectin-3 CRD [49940] (1 species)
  7. 1780838Species Human (Homo sapiens) [TaxId:9606] [49941] (30 PDB entries)
  8. 1780840Domain d3zska_: 3zsk A: [186540]
    automated match to d1a3ka_
    complexed with gol

Details for d3zska_

PDB Entry: 3zsk (more details), 0.9 Å

PDB Description: crystal structure of human galectin-3 crd with glycerol bound at 0.90 angstrom resolution
PDB Compounds: (A:) Galectin-3

SCOPe Domain Sequences for d3zska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zska_ b.29.1.3 (A:) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]}
mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
klgisgdidltsasytmi

SCOPe Domain Coordinates for d3zska_:

Click to download the PDB-style file with coordinates for d3zska_.
(The format of our PDB-style files is described here.)

Timeline for d3zska_: