Lineage for d3zr0b_ (3zr0 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.1: MutT-like [55812] (17 proteins) 
Protein automated matches [190465] (6 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries) 
Domain d3zr0b_: 3zr0 B: [186524]
automated match to d1irya_
protein/DNA complex; complexed with 8og, so4
Details for d3zr0b_
PDB Entry: 3zr0 (more details), 1.8 Å
PDB Description: crystal structure of human mth1 in complex with 8-oxo-dgmp
PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphataseSCOPe Domain Sequences for d3zr0b_:
Sequence, based on SEQRES records: (download)
>d3zr0b_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltv
dalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdds
ywfplllqkkkfhgyfkfqgqdtildytlrevdtv
Sequence, based on observed residues (ATOM records): (download)
>d3zr0b_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gasrlytlvlvlvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvdalh
kvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsywfp
lllqkkkfhgyfkfqgqdtildytlrevdtv
SCOPe Domain Coordinates for d3zr0b_:
Click to download the PDB-style file with coordinates for d3zr0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zr0b_:
- d3zr0b_ first appeared in SCOPe 2.01
- d3zr0b_ appears in SCOPe 2.07
View in 3D
